PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10003204m
Common NameCARUB_v10003204mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family HB-other
Protein Properties Length: 875aa    MW: 97099 Da    PI: 8.6498
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10003204mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox18.14.7e-0666122157
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                      +r+R  ++++ ++ L+++F+ +  +s++e +e+++  g+t +qV+ +F  ++++ ++
  Carubv10003204m  66 KRPRDLLNPKAVKYLQAVFAVKDAISKRESREISALFGITVAQVREFFVTQKTRVRR 122
                      799*********************************************999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.65363123IPR001356Homeobox domain
SuperFamilySSF466898.55E-664125IPR009057Homeodomain-like
SMARTSM003898.5E-565127IPR001356Homeobox domain
CDDcd000860.001166123No hitNo description
Gene3DG3DSA:1.10.10.601.4E-466125IPR009057Homeodomain-like
Gene3DG3DSA:1.20.930.101.7E-4228322IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476763.92E-5231324IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 875 aa     Download sequence    Send to blast
MDAFNEEIEI GSSVESLMEL LDSQKVLFHS QINQLQDVVV TQCKLTGVNP LAQEMAAGAL  60
SINIGKRPRD LLNPKAVKYL QAVFAVKDAI SKRESREISA LFGITVAQVR EFFVTQKTRV  120
RRQVRLSREK VILSNTDALQ GDGVPEDNNG TNHVDPVPLN SIHPEACSIS WSAAETVALI  180
PPEDIPPDIS DSDKYFVENI FALLRKEESF SGQVKLMEWI MQIQDSSVLI WFLSKGGVLI  240
LTTWLSQAAV EEQTSVILLI LKVLCHLPLH KASPENMSAI LQSVNGLRFY RTSDISNRAK  300
GLLSRWTKLF AKIQAMKKQN RNNSQIDSQS QLLLKQSIAE IMGDSSNPED ILSLSNGRSE  360
NVRRFESSQG PKLLLTSADD STKKHMLGST PSYNKERRKV QMVEQPGQKA AGKSPQTVRI  420
GTSSRSRPMS ADDIQKAKMR ALFMQSKNSK KDPLPSAIGD SRTIVPEKPL ALESSKDFPP  480
SQNNEAKTED TYVPLAVQPV NGPAVIVKFS AGMVLDEVWR VATGGNSKEA DVQRNRNRRE  540
RETTYQSLQT IPLNPKEPWD REMDFDDTLT PEIPSQQPPD ESITEPQNSL DERRTAASAA  600
TTSSSLSSPE PDLELLAALL KNPDLVYALT SGKPSNLAGQ DMVKLLDVIK TGAPNSSSSS  660
NKQAEEKVEV SLPSPTPSTN PGMSGWGQEA IRNPFSRQKQ VGAPVARLVT QHHVTNSMQW  720
QSTNEQAIPR HATAAYNNSL ILPHTERQQQ QHMQPQLHHN HHLQQQPMST TSYGVREPVG  780
QMGTATLGSW RLQQSQNSYY SHQANDVASV SQSSSYQGNN QYMSSSNPGY ESWSPDHSPS  840
RNHPNIRGGQ QQQQPSRKHD SSSHPYWNQN KRWR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2267460.0AK226746.1 Arabidopsis thaliana mRNA for luminidependens protein, complete cds, clone: RAFL07-75-C15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006289646.10.0hypothetical protein CARUB_v10003204mg
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLR0H0240.0R0H024_9BRAS; Uncharacterized protein
STRINGscaffold_604015.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein